Lineage for d1dx5.1 (1dx5 A:,M:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 protein domains)
  6. 15170Protein Thrombin [50531] (2 species)
  7. 15205Species Human (Homo sapiens) [TaxId:9606] [50532] (112 PDB entries)
  8. 15283Domain d1dx5.1: 1dx5 A:,M: [26155]
    Other proteins in same PDB: d1dx5i1, d1dx5i2, d1dx5i3, d1dx5j1, d1dx5j2, d1dx5j3, d1dx5k1, d1dx5k2, d1dx5k3, d1dx5l1, d1dx5l2, d1dx5l3

Details for d1dx5.1

PDB Entry: 1dx5 (more details), 2.3 Å

PDB Description: crystal structure of the thrombin-thrombomodulin complex

SCOP Domain Sequences for d1dx5.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dx5.1 b.47.1.2 (A:,M:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknfiendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOP Domain Coordinates for d1dx5.1:

Click to download the PDB-style file with coordinates for d1dx5.1.
(The format of our PDB-style files is described here.)

Timeline for d1dx5.1: