SCOPe 2.04: Domain d4oyta_: 4oyt A:

Lineage for d4oyta_ (4oyt A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (83 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:126793] [261543] (3 PDB entries)

8. Domain d4oyta_: 4oyt A: [261545]
   automated match to d3ou5a_
   complexed with 1w9, etf, fon, gol, trs

Details for d4oyta_

PDB Entry: 4oyt, 2.4 Å

PDB Description: crystal structure of ternary complex of plasmodium vivax shmt with d- serine and folinic acid

PDB Compounds: (A:) Serine hydroxymethyltransferase, putative

SCOPe Domain Sequences for d4oyta_:

Sequence; same for both SEQRES and ATOM records:

>d4oyta_ c.67.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

Timeline for d4oyta_:

• d4oyta_ is new in SCOPe 2.04-stable
  
• d4oyta_ appears in SCOPe 2.05
  
• d4oyta_ appears in the current release, SCOPe 2.08