SCOPe 2.05: Domain d4omoa_: 4omo A:

Lineage for d4omoa_ (4omo A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225620] (11 PDB entries)

8. Domain d4omoa_: 4omo A: [261542]
   automated match to d1e6ga_
   complexed with epe, ni; mutant

Details for d4omoa_

PDB Entry: 4omo, 1.04 Å

PDB Description: Crystal structure of the c-Src tyrosine kinase SH3 domain mutant Q128E

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4omoa_:

Sequence; same for both SEQRES and ATOM records:

>d4omoa_ b.34.2.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgetgyipsnyvaps
d

Timeline for d4omoa_:

• d4omoa_ first appeared in SCOPe 2.04
  
• d4omoa_ is called d4omoa1 in SCOPe 2.06
  
• d4omoa_ appears in the current release, SCOPe 2.08, called d4omoa1