SCOPe 2.06: Domain d4o6pc_: 4o6p C:

Lineage for d4o6pc_ (4o6p C:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.49: Recombination protein RecR [111303] (1 superfamily)
   consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer)

4. Superfamily e.49.1: Recombination protein RecR [111304] (1 family)

5. Family e.49.1.1: Recombination protein RecR [111305] (1 protein)
   three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively

6. Protein Recombination protein RecR [111306] (2 species)

7. Species Thermoanaerobacter tengcongensis [TaxId:273068] [193312] (4 PDB entries)

8. Domain d4o6pc_: 4o6p C: [261541]
   automated match to d3vdpd_
   complexed with zn; mutant

Details for d4o6pc_

PDB Entry: 4o6p, 3 Å

PDB Description: structural and functional studies the characterization of c58g/c70g mutant in cys4 zinc-finger motif in the recombination mediator protein recr

PDB Compounds: (C:) recombination protein recr

SCOPe Domain Sequences for d4o6pc_:

Sequence; same for both SEQRES and ATOM records:

>d4o6pc_ e.49.1.1 (C:) Recombination protein RecR {Thermoanaerobacter tengcongensis [TaxId: 273068]}
yystsvaklieelsklpgigpktaqrlaffiinmpldevrslsqaiieakeklryckigf
nitdkevcdigsdenrdhsticvvshpmdvvamekvkeykgvyhvlhgvispiegvgped
irikellervrdgsvkevilatnpdiegeatamyiakllkpfgvkvtriahgipvggdle
ytdvvtlskalegrre

Timeline for d4o6pc_:

• d4o6pc_ first appeared in SCOPe 2.04
  
• d4o6pc_ appears in SCOPe 2.05
  
• d4o6pc_ appears in SCOPe 2.07
  
• d4o6pc_ appears in the current release, SCOPe 2.08