Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.49: Recombination protein RecR [111303] (1 superfamily) consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer) |
Superfamily e.49.1: Recombination protein RecR [111304] (1 family) |
Family e.49.1.1: Recombination protein RecR [111305] (1 protein) three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively |
Protein Recombination protein RecR [111306] (2 species) |
Species Thermoanaerobacter tengcongensis [TaxId:273068] [193312] (4 PDB entries) |
Domain d4o6oa_: 4o6o A: [261540] automated match to d3vdpd_ complexed with imd, zn |
PDB Entry: 4o6o (more details), 3 Å
SCOPe Domain Sequences for d4o6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o6oa_ e.49.1.1 (A:) Recombination protein RecR {Thermoanaerobacter tengcongensis [TaxId: 273068]} yystsvaklieelsklpgigpktaqrlaffiinmpldevrslsqaiieakeklrygkicf nitdkevcdicsdenrdhsticvvshpmdvvamekvkeykgvyhvlhgvispiegvgped irikellervrdgsvkevilatnpdiegeatamyiakllkpfgvkvtriahgipvggdle ytdvvtlskalegrrev
Timeline for d4o6oa_: