Lineage for d4o6pb_ (4o6p B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954731Fold e.49: Recombination protein RecR [111303] (1 superfamily)
    consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer)
  4. 1954732Superfamily e.49.1: Recombination protein RecR [111304] (1 family) (S)
  5. 1954733Family e.49.1.1: Recombination protein RecR [111305] (1 protein)
    three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively
  6. 1954734Protein Recombination protein RecR [111306] (2 species)
  7. 1954742Species Thermoanaerobacter tengcongensis [TaxId:273068] [193312] (4 PDB entries)
  8. 1954752Domain d4o6pb_: 4o6p B: [261539]
    automated match to d3vdpd_
    complexed with zn; mutant

Details for d4o6pb_

PDB Entry: 4o6p (more details), 3 Å

PDB Description: structural and functional studies the characterization of c58g/c70g mutant in cys4 zinc-finger motif in the recombination mediator protein recr
PDB Compounds: (B:) recombination protein recr

SCOPe Domain Sequences for d4o6pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o6pb_ e.49.1.1 (B:) Recombination protein RecR {Thermoanaerobacter tengcongensis [TaxId: 273068]}
yystsvaklieelsklpgigpktaqrlaffiinmpldevrslsqaiieakeklryckigf
nitdkevcdigsdenrdhsticvvshpmdvvamekvkeykgvyhvlhgvispiegvgped
irikellervrdgsvkevilatnpdiegeatamyiakllkpfgvkvtriahgipvggdle
ytdvvtlskalegrrev

SCOPe Domain Coordinates for d4o6pb_:

Click to download the PDB-style file with coordinates for d4o6pb_.
(The format of our PDB-style files is described here.)

Timeline for d4o6pb_: