Lineage for d4nwfb3 (4nwf B:219-533)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116663Species Human (Homo sapiens) [TaxId:9606] [187400] (116 PDB entries)
  8. 2116793Domain d4nwfb3: 4nwf B:219-533 [261533]
    Other proteins in same PDB: d4nwfa1, d4nwfa2, d4nwfb1, d4nwfb2
    automated match to d2b3oa3
    complexed with edo, gol; mutant

Details for d4nwfb3

PDB Entry: 4nwf (more details), 2.1 Å

PDB Description: Crystal structure of the tyrosine phosphatase SHP-2 with N308D mutation
PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4nwfb3:

Sequence, based on SEQRES records: (download)

>d4nwfb3 c.45.1.0 (B:219-533) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
yknilpfdhtrvvlhdgdpnepvsdyinadiimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhyietlqrrieeeq

Sequence, based on observed residues (ATOM records): (download)

>d4nwfb3 c.45.1.0 (B:219-533) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelskgfweefetlqqqeckllysrkegqrqenknknryknilpfdht
rvvlhdgdpnvsdyinadiimpeksyiatqgclqntvndfwrmvfqensrvivmttkeve
rgkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfr
twpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiire
kgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeq

SCOPe Domain Coordinates for d4nwfb3:

Click to download the PDB-style file with coordinates for d4nwfb3.
(The format of our PDB-style files is described here.)

Timeline for d4nwfb3: