SCOPe 2.08: Domain d4nnpy2: 4nnp Y:109-213

Lineage for d4nnpy2 (4nnp Y:109-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4nnpy2: 4nnp Y:109-213 [261532]
   Other proteins in same PDB: d4nnpa_, d4nnpb_, d4nnph_, d4nnpl1, d4nnpx_, d4nnpy1
   automated match to d4jg1l2

Details for d4nnpy2

PDB Entry: 4nnp, 2.69 Å

PDB Description: crystal structure of apo manganese abc transporter mntc from staphylococcus aureus bound to an antagonistic fab fragment

PDB Compounds: (Y:) Light chain of antagonistic fab fragment

SCOPe Domain Sequences for d4nnpy2:

Sequence; same for both SEQRES and ATOM records:

>d4nnpy2 b.1.1.2 (Y:109-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4nnpy2:

• d4nnpy2 first appeared in SCOPe 2.04
  
• d4nnpy2 appears in SCOPe 2.07