SCOPe 2.04: Domain d4nwga2: 4nwg A:111-218

Lineage for d4nwga2 (4nwg A:111-218)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)

8. Domain d4nwga2: 4nwg A:111-218 [261531]
   Other proteins in same PDB: d4nwga3
   automated match to d2b3oa2
   complexed with edo, peg, so4; mutant

Details for d4nwga2

PDB Entry: 4nwg, 2.45 Å

PDB Description: Crystal structure of the tyrosine phosphatase SHP-2 with E139D mutation

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4nwga2:

Sequence, based on SEQRES records:

>d4nwga2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvrdsqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records):

>d4nwga2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgaeklltekgkhgsflvrdsqshpgdfvlsvrtgdskvthvmircqelkydv
gggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Timeline for d4nwga2:

• d4nwga2 is new in SCOPe 2.04-stable
  
• d4nwga2 appears in SCOPe 2.05
  
• d4nwga2 appears in the current release, SCOPe 2.08