Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
Domain d4nwga2: 4nwg A:111-218 [261531] Other proteins in same PDB: d4nwga3, d4nwgb3 automated match to d2b3oa2 complexed with edo, peg, so4; mutant |
PDB Entry: 4nwg (more details), 2.45 Å
SCOPe Domain Sequences for d4nwga2:
Sequence, based on SEQRES records: (download)
>d4nwga2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} rwfhghlsgkeaeklltekgkhgsflvrdsqshpgdfvlsvrtgddkgesndgkskvthv mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt
>d4nwga2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} rwfhghlsgaeklltekgkhgsflvrdsqshpgdfvlsvrtgdskvthvmircqelkydv gggerfdsltdlvehykknpmvetlgtvlqlkqplnt
Timeline for d4nwga2: