Lineage for d4nnpy1 (4nnp Y:1-108)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520264Domain d4nnpy1: 4nnp Y:1-108 [261529]
    Other proteins in same PDB: d4nnpa_, d4nnpb_, d4nnpl2, d4nnpy2
    automated match to d3pgfl1

Details for d4nnpy1

PDB Entry: 4nnp (more details), 2.69 Å

PDB Description: crystal structure of apo manganese abc transporter mntc from staphylococcus aureus bound to an antagonistic fab fragment
PDB Compounds: (Y:) Light chain of antagonistic fab fragment

SCOPe Domain Sequences for d4nnpy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnpy1 b.1.1.0 (Y:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
rfsgsrsgtdftltisslqpedfatyycqqsyysspftfgqgtkveik

SCOPe Domain Coordinates for d4nnpy1:

Click to download the PDB-style file with coordinates for d4nnpy1.
(The format of our PDB-style files is described here.)

Timeline for d4nnpy1: