Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4nnpl2: 4nnp L:109-213 [261528] Other proteins in same PDB: d4nnpa_, d4nnpb_, d4nnpl1, d4nnpy1 automated match to d4jg1l2 |
PDB Entry: 4nnp (more details), 2.69 Å
SCOPe Domain Sequences for d4nnpl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nnpl2 b.1.1.2 (L:109-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d4nnpl2:
View in 3D Domains from other chains: (mouse over for more information) d4nnpa_, d4nnpb_, d4nnpy1, d4nnpy2 |