SCOPe 2.07: Domain d4nwfb1: 4nwf B:3-110

Lineage for d4nwfb1 (4nwf B:3-110)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)

8. Domain d4nwfb1: 4nwf B:3-110 [261525]
   Other proteins in same PDB: d4nwfa3, d4nwfb3
   automated match to d2b3oa1
   complexed with edo, gol; mutant

Details for d4nwfb1

PDB Entry: 4nwf, 2.1 Å

PDB Description: Crystal structure of the tyrosine phosphatase SHP-2 with N308D mutation

PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4nwfb1:

Sequence, based on SEQRES records:

>d4nwfb1 d.93.1.0 (B:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Sequence, based on observed residues (ATOM records):

>d4nwfb1 d.93.1.0 (B:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehgqlkvielkyplncadptse

Timeline for d4nwfb1:

• d4nwfb1 first appeared in SCOPe 2.04
  
• d4nwfb1 appears in SCOPe 2.06
  
• d4nwfb1 appears in the current release, SCOPe 2.08