SCOPe 2.08: Domain d4nrgb_: 4nrg B:

Lineage for d4nrgb_ (4nrg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d4nrgb_: 4nrg B: [261523]
   Other proteins in same PDB: d4nrga_
   automated match to d1x23d_
   mutant

Details for d4nrgb_

PDB Entry: 4nrg, 1.95 Å

PDB Description: Crystal Structure of a human Mms2/Ubc13 D118G mutant

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4nrgb_:

Sequence, based on SEQRES records:

>d4nrgb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpgdpl
andvaeqwktneaqaietarawtrlyamn

Sequence, based on observed residues (ATOM records):

>d4nrgb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpgdpn
dvaeqwktneaqaietarawtrlyamn

Timeline for d4nrgb_:

• d4nrgb_ first appeared in SCOPe 2.04
  
• d4nrgb_ appears in SCOPe 2.07