Lineage for d4nr3a_ (4nr3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939066Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (6 PDB entries)
  8. 2939069Domain d4nr3a_: 4nr3 A: [261520]
    Other proteins in same PDB: d4nr3b_
    automated match to d1j7da_
    mutant

Details for d4nr3a_

PDB Entry: 4nr3 (more details), 1.8 Å

PDB Description: crystal structure of a human mms2/ubc13 l121g mutant
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 2

SCOPe Domain Sequences for d4nr3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nr3a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqtynn

SCOPe Domain Coordinates for d4nr3a_:

Click to download the PDB-style file with coordinates for d4nr3a_.
(The format of our PDB-style files is described here.)

Timeline for d4nr3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4nr3b_