Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (40 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [261218] (2 PDB entries) |
Domain d4nnpb_: 4nnp B: [261511] Other proteins in same PDB: d4nnph_, d4nnpl1, d4nnpl2, d4nnpx_, d4nnpy1, d4nnpy2 automated match to d4k3va_ |
PDB Entry: 4nnp (more details), 2.69 Å
SCOPe Domain Sequences for d4nnpb_:
Sequence, based on SEQRES records: (download)
>d4nnpb_ c.92.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln letgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngiky vktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafky fskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetk kdifgevytdsigkegtkgdsyykmmksnietvhgsmk
>d4nnpb_ c.92.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln letgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngiky vktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafky fskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetf gevytdsigkegtkgdsyykmmksnietvhgsmk
Timeline for d4nnpb_: