Lineage for d4nnpa_ (4nnp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143646Species Staphylococcus aureus [TaxId:158878] [261218] (2 PDB entries)
  8. 2143648Domain d4nnpa_: 4nnp A: [261510]
    Other proteins in same PDB: d4nnpl1, d4nnpl2, d4nnpy1, d4nnpy2
    automated match to d4k3va_

Details for d4nnpa_

PDB Entry: 4nnp (more details), 2.69 Å

PDB Description: crystal structure of apo manganese abc transporter mntc from staphylococcus aureus bound to an antagonistic fab fragment
PDB Compounds: (A:) Lipoprotein

SCOPe Domain Sequences for d4nnpa_:

Sequence, based on SEQRES records: (download)

>d4nnpa_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln
letgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngiky
vktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafky
fskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetk
kdifgevytdsigkegtkgdsyykmmksnietvhgsmk

Sequence, based on observed residues (ATOM records): (download)

>d4nnpa_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
klkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngln
letgngwfekaleqagkslkdkkviavskdvkpiylneegnkdkqdphawlsldngikyv
ktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafkyf
skqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseeifg
evytdsigkegtkgdsyykmmksnietvhgsmk

SCOPe Domain Coordinates for d4nnpa_:

Click to download the PDB-style file with coordinates for d4nnpa_.
(The format of our PDB-style files is described here.)

Timeline for d4nnpa_: