Lineage for d4d7na2 (4d7n A:68-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011877Protein automated matches [226970] (7 species)
    not a true protein
  7. 2011894Species Escherichia coli [TaxId:562] [226229] (9 PDB entries)
  8. 2011902Domain d4d7na2: 4d7n A:68-209 [261505]
    Other proteins in same PDB: d4d7na1, d4d7na3
    automated match to d2xpwa2
    complexed with cl, k, tdc

Details for d4d7na2

PDB Entry: 4d7n (more details), 1.76 Å

PDB Description: tetr(d) in complex with anhydrotetracycline and potassium
PDB Compounds: (A:) tetracycline repressor, class d

SCOPe Domain Sequences for d4d7na2:

Sequence, based on SEQRES records: (download)

>d4d7na2 a.121.1.1 (A:68-209) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqivg

Sequence, based on observed residues (ATOM records): (download)

>d4d7na2 a.121.1.1 (A:68-209) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtanlppllrealqimdsddgeqaflhgleslirgfe
vqltallqivg

SCOPe Domain Coordinates for d4d7na2:

Click to download the PDB-style file with coordinates for d4d7na2.
(The format of our PDB-style files is described here.)

Timeline for d4d7na2: