Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (22 species) not a true protein |
Species Escherichia coli [TaxId:562] [226228] (11 PDB entries) |
Domain d4d7na1: 4d7n A:3-67 [261502] Other proteins in same PDB: d4d7na2, d4d7na3 automated match to d1a6ia1 complexed with cl, k, tdc |
PDB Entry: 4d7n (more details), 1.76 Å
SCOPe Domain Sequences for d4d7na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d7na1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 562]} rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar hhdys
Timeline for d4d7na1: