Lineage for d4d7na1 (4d7n A:3-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692752Species Escherichia coli [TaxId:562] [226228] (11 PDB entries)
  8. 2692759Domain d4d7na1: 4d7n A:3-67 [261502]
    Other proteins in same PDB: d4d7na2, d4d7na3
    automated match to d1a6ia1
    complexed with cl, k, tdc

Details for d4d7na1

PDB Entry: 4d7n (more details), 1.76 Å

PDB Description: tetr(d) in complex with anhydrotetracycline and potassium
PDB Compounds: (A:) tetracycline repressor, class d

SCOPe Domain Sequences for d4d7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d7na1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d4d7na1:

Click to download the PDB-style file with coordinates for d4d7na1.
(The format of our PDB-style files is described here.)

Timeline for d4d7na1: