Lineage for d4d3ed_ (4d3e D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754530Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 1754531Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 1754553Family a.250.1.0: automated matches [254281] (1 protein)
    not a true family
  6. 1754554Protein automated matches [254655] (2 species)
    not a true protein
  7. 1754559Species Shigella flexneri [TaxId:1086030] [261499] (1 PDB entry)
  8. 1754560Domain d4d3ed_: 4d3e D: [261500]
    automated match to d2ym9c_

Details for d4d3ed_

PDB Entry: 4d3e (more details), 2.12 Å

PDB Description: tetramer of ipad, modified from 2j0o, fitted into negative stain electron microscopy reconstruction of the wild type tip complex from the type iii secretion system of shigella flexneri
PDB Compounds: (D:) invasin ipad

SCOPe Domain Sequences for d4d3ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d3ed_ a.250.1.0 (D:) automated matches {Shigella flexneri [TaxId: 1086030]}
gdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispggnd
gnsvklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqknggy
vvsinmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqkysna
nsifdnlvkvlsstissctdtdklflhf

SCOPe Domain Coordinates for d4d3ed_:

Click to download the PDB-style file with coordinates for d4d3ed_.
(The format of our PDB-style files is described here.)

Timeline for d4d3ed_: