![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.250: IpaD-like [140692] (1 superfamily) 6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest |
![]() | Superfamily a.250.1: IpaD-like [140693] (2 families) ![]() |
![]() | Family a.250.1.0: automated matches [254281] (1 protein) not a true family |
![]() | Protein automated matches [254655] (2 species) not a true protein |
![]() | Species Shigella flexneri [TaxId:1086030] [261499] (1 PDB entry) |
![]() | Domain d4d3ed_: 4d3e D: [261500] automated match to d2ym9c_ |
PDB Entry: 4d3e (more details), 2.12 Å
SCOPe Domain Sequences for d4d3ed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d3ed_ a.250.1.0 (D:) automated matches {Shigella flexneri [TaxId: 1086030]} gdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispggnd gnsvklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqknggy vvsinmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqkysna nsifdnlvkvlsstissctdtdklflhf
Timeline for d4d3ed_: