Lineage for d4czna_ (4czn A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2328588Protein automated matches [190089] (8 species)
    not a true protein
  7. 2328621Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries)
  8. 2328622Domain d4czna_: 4czn A: [261493]
    automated match to d1mnpa_
    complexed with ca, hem, na

Details for d4czna_

PDB Entry: 4czn (more details), 1.2 Å

PDB Description: Crystal structure of the extralong fungal manganese peroxidase from Ceriporiopsis subvermispora
PDB Compounds: (A:) extralong manganese peroxidase

SCOPe Domain Sequences for d4czna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czna_ a.93.1.1 (A:) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]}
ptavcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgps
agggadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncp
gaprvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiara
dkvdptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdt
glmrlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvp
vpkpavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfs
gpatds

SCOPe Domain Coordinates for d4czna_:

Click to download the PDB-style file with coordinates for d4czna_.
(The format of our PDB-style files is described here.)

Timeline for d4czna_: