Lineage for d4wjka_ (4wjk A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066356Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2066409Family b.69.8.0: automated matches [233848] (1 protein)
    not a true family
  6. 2066410Protein automated matches [233850] (1 species)
    not a true protein
  7. 2066411Species Human (Homo sapiens) [TaxId:9606] [233851] (2 PDB entries)
  8. 2066412Domain d4wjka_: 4wjk A: [261479]
    automated match to d3niga_
    complexed with ca, mg, nag

Details for d4wjka_

PDB Entry: 4wjk (more details), 1.85 Å

PDB Description: metal ion and ligand binding of integrin
PDB Compounds: (A:) Integrin alpha-5

SCOPe Domain Sequences for d4wjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wjka_ b.69.8.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldaeapavlsgppgsffgfsvefyrpgtdgvsvlvgapkantsqpgvlqggavylcpw
gasptqctpiefdskgsrllesslsssegeepveykslqwfgatvrahgssilacaplys
wrtekeplsdpvgtcylstdnftrileyapcrsdfswaagqgycqggfsaeftktgrvvl
ggpgsyfwqgqilsatqeqiaesyypeylinlvqgqlqtrqassiyddsylgysvavgef
sgddtedfvagvpkgnltygyvtilngsdirslynfsgeqmasyfgyavaatdvngdgld
dllvgapllmdrtpdgrpqevgrvyvylqhpagieptptltltghdefgrfgssltplgd
ldqdgyndvaigapfggetqqgvvfvfpggpgglgskpsqvlqplwaashtpdffgsalr
ggrdldgngypdlivgsfgvdkavvyrgrpvv

SCOPe Domain Coordinates for d4wjka_:

Click to download the PDB-style file with coordinates for d4wjka_.
(The format of our PDB-style files is described here.)

Timeline for d4wjka_: