Lineage for d4wjgd_ (4wjg D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766796Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2766810Protein Iron-regulated surface determinant protein H, IsdH [158917] (1 species)
  7. 2766811Species Staphylococcus aureus [TaxId:1280] [158918] (2 PDB entries)
    Uniprot Q6G8J7 86-229
  8. 2766813Domain d4wjgd_: 4wjg D: [261477]
    Other proteins in same PDB: d4wjg1_, d4wjga_, d4wjgb_, d4wjgf_, d4wjgg_, d4wjgk_, d4wjgl_, d4wjgp_, d4wjgq_, d4wjgu_, d4wjgv_, d4wjgz_
    automated match to d2h3ka1
    complexed with hem, nag, oxy

Details for d4wjgd_

PDB Entry: 4wjg (more details), 3.1 Å

PDB Description: structure of t. brucei haptoglobin-hemoglobin receptor binding to human haptoglobin-hemoglobin
PDB Compounds: (D:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d4wjgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wjgd_ b.1.28.1 (D:) Iron-regulated surface determinant protein H, IsdH {Staphylococcus aureus [TaxId: 1280]}
adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae
veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid
dgeetnydytklvfakpiyndpsl

SCOPe Domain Coordinates for d4wjgd_:

Click to download the PDB-style file with coordinates for d4wjgd_.
(The format of our PDB-style files is described here.)

Timeline for d4wjgd_: