Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (287 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d4wjga_: 4wjg A: [261476] Other proteins in same PDB: d4wjg1_, d4wjg3_, d4wjgb_, d4wjgd_, d4wjgg_, d4wjgi_, d4wjgl_, d4wjgn_, d4wjgq_, d4wjgs_, d4wjgv_, d4wjgx_ automated match to d1bz1a_ complexed with hem, nag, oxy |
PDB Entry: 4wjg (more details), 3.1 Å
SCOPe Domain Sequences for d4wjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wjga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d4wjga_: