SCOPe 2.04: Domain d4wh8b_: 4wh8 B:

Lineage for d4wh8b_ (4wh8 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (4 species)
   not a true protein

7. Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (17 PDB entries)

8. Domain d4wh8b_: 4wh8 B: [261475]
   automated match to d3m5la_
   complexed with 3m7, so4, zn

Details for d4wh8b_

PDB Entry: 4wh8, 2.7 Å

PDB Description: crystal structure of hcv ns3/4a protease in complex with an asunaprevir p1-p3 macrocyclic analog.

PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d4wh8b_:

Sequence; same for both SEQRES and ATOM records:

>d4wh8b_ b.47.1.3 (B:) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
hmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatq
tflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgs
sdlylvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavctr
gvakavdfipveslettm

Timeline for d4wh8b_:

• d4wh8b_ is new in SCOPe 2.04-stable
  
• d4wh8b_ appears in SCOPe 2.05
  
• d4wh8b_ appears in the current release, SCOPe 2.08, called d4wh8b1