Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d4wffd2: 4wff D:107-211 [261473] Other proteins in same PDB: d4wffd1, d4wffe_, d4wfff1, d4wffg_ automated match to d3gnml2 complexed with ca, d10, k |
PDB Entry: 4wff (more details), 2.5 Å
SCOPe Domain Sequences for d4wffd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wffd2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4wffd2:
View in 3D Domains from other chains: (mouse over for more information) d4wffe_, d4wfff1, d4wfff2, d4wffg_ |