SCOPe 2.04: Domain d4we1a2: 4we1 A:430-548

Lineage for d4we1a2 (4we1 A:430-548)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (26 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11678] [261468] (1 PDB entry)

8. Domain d4we1a2: 4we1 A:430-548 [261469]
   Other proteins in same PDB: d4we1a1, d4we1b_
   automated match to d2ykna2
   complexed with 3lq, mg, so4

Details for d4we1a2

PDB Entry: 4we1, 2.49 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 5-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2- naphthonitrile (jlj600)

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4we1a2:

Sequence; same for both SEQRES and ATOM records:

>d4we1a2 c.55.3.0 (A:430-548) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqv

Timeline for d4we1a2:

• d4we1a2 is new in SCOPe 2.04-stable
  
• d4we1a2 appears in SCOPe 2.05
  
• d4we1a2 appears in the current release, SCOPe 2.08