Lineage for d4we1a2 (4we1 A:430-548)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887379Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11678] [261468] (27 PDB entries)
  8. 2887404Domain d4we1a2: 4we1 A:430-548 [261469]
    Other proteins in same PDB: d4we1a1, d4we1b_
    automated match to d2ykna2
    complexed with 3lq, mg, so4

Details for d4we1a2

PDB Entry: 4we1 (more details), 2.49 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 5-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2- naphthonitrile (jlj600)
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4we1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4we1a2 c.55.3.0 (A:430-548) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqv

SCOPe Domain Coordinates for d4we1a2:

Click to download the PDB-style file with coordinates for d4we1a2.
(The format of our PDB-style files is described here.)

Timeline for d4we1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4we1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d4we1b_