Lineage for d4wczb_ (4wcz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854136Species Novosphingobium aromaticivorans [TaxId:279238] [226680] (3 PDB entries)
  8. 2854139Domain d4wczb_: 4wcz B: [261466]
    Other proteins in same PDB: d4wczc2, d4wczf2
    automated match to d4olqe_

Details for d4wczb_

PDB Entry: 4wcz (more details), 1.82 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from novosphingobium aromaticivorans
PDB Compounds: (B:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4wczb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wczb_ c.14.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
mslrlerdgavarllidradrrnafsldmwqrlpellaeasgddalrvlvvksanggafc
agadiaellankddaafhaanqqainraqyelarfrlptvamvegdcigggcgialacdm
riaapaarfgitpaklglvyplhdvkllvdlvgpgqarrlmftgglidaneahriglvel
lgesedalvgqlatvssfstqaiksfvrrvldgqvaddadslrvfasafegadfregtga
flekrppvf

SCOPe Domain Coordinates for d4wczb_:

Click to download the PDB-style file with coordinates for d4wczb_.
(The format of our PDB-style files is described here.)

Timeline for d4wczb_: