SCOPe 2.05: Domain d4w9oe_: 4w9o E:

Lineage for d4w9oe_ (4w9o E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (38 PDB entries)

8. Domain d4w9oe_: 4w9o E: [261463]
   automated match to d3o5qa_
   complexed with 3jq, act

Details for d4w9oe_

PDB Entry: 4w9o, 1.27 Å

PDB Description: The Fk1 domain of FKBP51 in complex with (1S,5S,6R)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1R)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one

PDB Compounds: (E:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4w9oe_:

Sequence; same for both SEQRES and ATOM records:

>d4w9oe_ d.26.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkg

Timeline for d4w9oe_:

• d4w9oe_ first appeared in SCOPe 2.04
  
• d4w9oe_ is called d4w9oe1 in SCOPe 2.06
  
• d4w9oe_ appears in the current release, SCOPe 2.08, called d4w9oe1