Lineage for d4v26a1 (4v26 A:6-169)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1732230Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1732231Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 1732250Protein automated matches [230549] (2 species)
    not a true protein
  7. 1732251Species Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries)
  8. 1732263Domain d4v26a1: 4v26 A:6-169 [261458]
    Other proteins in same PDB: d4v26a2
    automated match to d4mpna1
    complexed with 7tj, mg, tf3

Details for d4v26a1

PDB Entry: 4v26 (more details), 2.49 Å

PDB Description: ver-246608, a novel pan-isoform atp competitive inhibitor of pyruvate dehydrogenase kinase, disrupts warburg metabolism and induces context- dependent cytostasis in cancer cells
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d4v26a1:

Sequence, based on SEQRES records: (download)

>d4v26a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Sequence, based on observed residues (ATOM records): (download)

>d4v26a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asapkyiehfskfspsplsmkqfldfgsnacektsftflrqelpvrlanimkeinllpdr
vlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgv
leykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d4v26a1:

Click to download the PDB-style file with coordinates for d4v26a1.
(The format of our PDB-style files is described here.)

Timeline for d4v26a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4v26a2