Class a: All alpha proteins [46456] (286 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) automatically mapped to Pfam PF10436 |
Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) |
Protein automated matches [230549] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries) |
Domain d4v26a1: 4v26 A:6-169 [261458] Other proteins in same PDB: d4v26a2 automated match to d4mpna1 complexed with 7tj, mg, tf3 |
PDB Entry: 4v26 (more details), 2.49 Å
SCOPe Domain Sequences for d4v26a1:
Sequence, based on SEQRES records: (download)
>d4v26a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]} asapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
>d4v26a1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]} asapkyiehfskfspsplsmkqfldfgsnacektsftflrqelpvrlanimkeinllpdr vlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgv leykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
Timeline for d4v26a1: