SCOPe 2.08: Domain d4uwja1: 4uwj A:101-262

Lineage for d4uwja1 (4uwj A:101-262)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Aspergillus fumigatus [TaxId:746128] [259642] (6 PDB entries)

8. Domain d4uwja1: 4uwj A:101-262 [261453]
   automated match to d1iica1
   complexed with 7l5, mya

Details for d4uwja1

PDB Entry: 4uwj, 1.7 Å

PDB Description: crystal structure of aspergillus fumigatus n-myristoyl transferase in complex with myristoyl coa and a capped pyrazole sulphonamide ligand

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4uwja1:

Sequence; same for both SEQRES and ATOM records:

>d4uwja1 d.108.1.0 (A:101-262) automated matches {Aspergillus fumigatus [TaxId: 746128]}
ggpikiidpekvskepdallegfewatldltnetelqelwdlltyhyveddnamfrfrys
qsflhwalmspgwkkewhvgvratksrklvasicgvpteinvrnqklkvveinflcihkk
lrskrltpvlikeitrrcylngiyqaiytagvvlptpvsscr

Timeline for d4uwja1:

• d4uwja1 first appeared in SCOPe 2.04
  
• d4uwja1 appears in SCOPe 2.07