![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Aspergillus fumigatus [TaxId:746128] [259642] (6 PDB entries) |
![]() | Domain d4uwia1: 4uwi A:101-262 [261452] automated match to d1iica1 complexed with mya, xmq |
PDB Entry: 4uwi (more details), 1.8 Å
SCOPe Domain Sequences for d4uwia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uwia1 d.108.1.0 (A:101-262) automated matches {Aspergillus fumigatus [TaxId: 746128]} ggpikiidpekvskepdallegfewatldltnetelqelwdlltyhyveddnamfrfrys qsflhwalmspgwkkewhvgvratksrklvasicgvpteinvrnqklkvveinflcihkk lrskrltpvlikeitrrcylngiyqaiytagvvlptpvsscr
Timeline for d4uwia1: