Lineage for d1c4v.1 (1c4v 1:,2:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15170Protein Thrombin [50531] (2 species)
  7. 15205Species Human (Homo sapiens) [TaxId:9606] [50532] (112 PDB entries)
  8. 15268Domain d1c4v.1: 1c4v 1:,2: [26145]

Details for d1c4v.1

PDB Entry: 1c4v (more details), 2.1 Å

PDB Description: selective non electrophilic thrombin inhibitors with cyclohexyl moieties.

SCOP Domain Sequences for d1c4v.1:

Sequence, based on SEQRES records: (download)

>g1c4v.1 b.47.1.2 (1:,2:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Sequence, based on observed residues (ATOM records): (download)

>g1c4v.1 b.47.1.2 (1:,2:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOP Domain Coordinates for d1c4v.1:

Click to download the PDB-style file with coordinates for d1c4v.1.
(The format of our PDB-style files is described here.)

Timeline for d1c4v.1: