Lineage for d4ushb_ (4ush B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651485Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 1651486Protein automated matches [190753] (12 species)
    not a true protein
  7. 1651528Species Chlamydomonas reinhardtii [TaxId:3055] [261442] (2 PDB entries)
  8. 1651533Domain d4ushb_: 4ush B: [261447]
    automated match to d2o66b_
    complexed with so4

Details for d4ushb_

PDB Entry: 4ush (more details), 1.6 Å

PDB Description: Nitrogen regulatory protein PII from Chlamydomonas reinhardtii in unliganded state
PDB Compounds: (B:) nitrogen regulatory protein pii

SCOPe Domain Sequences for d4ushb_:

Sequence, based on SEQRES records: (download)

>d4ushb_ d.58.5.0 (B:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
iqcdlsafpgvkffrieaifrpwrlpfvidtlskygirgltntpvkgvgvqggsreryag
tefgpsnlvdkekldivvsraqvdavvrlvaasaytgeigdgkifvhpvaevvrirtae

Sequence, based on observed residues (ATOM records): (download)

>d4ushb_ d.58.5.0 (B:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
iqcdlsafpgvkffrieaifrpwrlpfvidtlskygirgltntpvkgfgpsnlvdkekld
ivvsraqvdavvrlvaasaytgeigdgkifvhpvaevvrirtae

SCOPe Domain Coordinates for d4ushb_:

Click to download the PDB-style file with coordinates for d4ushb_.
(The format of our PDB-style files is described here.)

Timeline for d4ushb_: