Lineage for d1bhx.1 (1bhx A:,B:,F:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 561609Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 562018Protein Thrombin [50531] (2 species)
  7. 562065Species Human (Homo sapiens) [TaxId:9606] [50532] (157 PDB entries)
  8. 562161Domain d1bhx.1: 1bhx A:,B:,F: [26143]
    complexed with r56

Details for d1bhx.1

PDB Entry: 1bhx (more details), 2.3 Å

PDB Description: x-ray structure of the complex of human alpha thrombin with the inhibitor sdz 229-357

SCOP Domain Sequences for d1bhx.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1bhx.1 b.47.1.2 (A:,B:,F:) Thrombin {Human (Homo sapiens)}
sgeadcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketXg
qpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspf
nnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOP Domain Coordinates for d1bhx.1:

Click to download the PDB-style file with coordinates for d1bhx.1.
(The format of our PDB-style files is described here.)

Timeline for d1bhx.1: