SCOPe 2.05: Domain d4ub6l_: 4ub6 L:

Lineage for d4ub6l_ (4ub6 L:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (5 PDB entries)

8. Domain d4ub6l_: 4ub6 L: [261422]
   Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6j_, d4ub6k_, d4ub6m_, d4ub6o_, d4ub6t_, d4ub6u_, d4ub6v_, d4ub6x_, d4ub6z_
   automated match to d2axtl1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub6l_

PDB Entry: 4ub6, 1.95 Å

PDB Description: native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d4ub6l_:

Sequence; same for both SEQRES and ATOM records:

>d4ub6l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d4ub6l_:

• d4ub6l_ first appeared in SCOPe 2.04
  
• d4ub6l_ appears in SCOPe 2.06
  
• d4ub6l_ appears in the current release, SCOPe 2.08