SCOPe 2.05: Domain d4rj2f_: 4rj2 F:

Lineage for d4rj2f_ (4rj2 F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (12 species)

7. Species Escherichia coli [TaxId:562] [53172] (27 PDB entries)

8. Domain d4rj2f_: 4rj2 F: [261407]
   automated match to d1k9sa_
   complexed with gol

Details for d4rj2f_

PDB Entry: 4rj2, 0.99 Å

PDB Description: Crystal structure of E.coli purine nucleoside phosphorylase at 0.99 A resolution

PDB Compounds: (F:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4rj2f_:

Sequence; same for both SEQRES and ATOM records:

>d4rj2f_ c.56.2.1 (F:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

Timeline for d4rj2f_:

• d4rj2f_ first appeared in SCOPe 2.04
  
• d4rj2f_ appears in SCOPe 2.06
  
• d4rj2f_ appears in the current release, SCOPe 2.08