Lineage for d4r5ja2 (4r5j A:508-605)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697230Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) (S)
  5. 2697231Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 2697246Protein automated matches [227118] (3 species)
    not a true protein
  7. 2697251Species Escherichia coli [TaxId:83333] [259518] (3 PDB entries)
  8. 2697254Domain d4r5ja2: 4r5j A:508-605 [261397]
    Other proteins in same PDB: d4r5ja1, d4r5ja3, d4r5jb1, d4r5jb3, d4r5jc1, d4r5jc3, d4r5jd1, d4r5jd3
    automated match to d1dkxa1
    complexed with ca, po4

Details for d4r5ja2

PDB Entry: 4r5j (more details), 2.36 Å

PDB Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-A)
PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d4r5ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r5ja2 a.8.4.1 (A:508-605) automated matches {Escherichia coli [TaxId: 83333]}
nedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaies
altaletalkgedkaaieakmqelaqvsqklmeiaqqq

SCOPe Domain Coordinates for d4r5ja2:

Click to download the PDB-style file with coordinates for d4r5ja2.
(The format of our PDB-style files is described here.)

Timeline for d4r5ja2: