SCOPe 2.07: Domain d4r5ja1: 4r5j A:389-503

Lineage for d4r5ja1 (4r5j A:389-503)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
   beta-sandwich: 8 strands in 2 sheets

4. Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family)

5. Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)

6. Protein automated matches [227117] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259516] (3 PDB entries)

8. Domain d4r5ja1: 4r5j A:389-503 [261396]
   Other proteins in same PDB: d4r5ja2, d4r5ja3, d4r5jb2, d4r5jb3, d4r5jc2, d4r5jc3, d4r5jd2, d4r5jd3
   automated match to d1dkxa2
   complexed with ca, po4

Details for d4r5ja1

PDB Entry: 4r5j, 2.36 Å

PDB Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-A)

PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d4r5ja1:

Sequence; same for both SEQRES and ATOM records:

>d4r5ja1 b.130.1.1 (A:389-503) automated matches {Escherichia coli [TaxId: 83333]}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitika

Timeline for d4r5ja1:

• d4r5ja1 first appeared in SCOPe 2.04
  
• d4r5ja1 appears in SCOPe 2.06
  
• d4r5ja1 appears in the current release, SCOPe 2.08