SCOPe 2.05: Domain d4ptna_: 4ptn A:

Lineage for d4ptna_ (4ptn A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries)

8. Domain d4ptna_: 4ptn A: [261387]
   automated match to d3n2xa_
   complexed with edo, gol, gxv, mg, pyr

Details for d4ptna_

PDB Entry: 4ptn, 1.99 Å

PDB Description: crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde

PDB Compounds: (A:) Probable 2-keto-3-deoxy-galactonate aldolase YagE

SCOPe Domain Sequences for d4ptna_:

Sequence; same for both SEQRES and ATOM records:

>d4ptna_ c.1.10.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc

Timeline for d4ptna_:

• d4ptna_ first appeared in SCOPe 2.04
  
• d4ptna_ appears in SCOPe 2.06
  
• d4ptna_ appears in the current release, SCOPe 2.08