![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Pseudomonas oleovorans [TaxId:301] [261363] (1 PDB entry) |
![]() | Domain d4o98a1: 4o98 A:26-323 [261364] Other proteins in same PDB: d4o98a2, d4o98b2 automated match to d4le6a_ complexed with zn; mutant |
PDB Entry: 4o98 (more details), 2.25 Å
SCOPe Domain Sequences for d4o98a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o98a1 d.157.1.0 (A:26-323) automated matches {Pseudomonas oleovorans [TaxId: 301]} apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha cglvnadgspaypnatvevpqaeaefwldeatmakapegmqgmfkmarqavapyakmnkl kpyktegellpgvslvassghtpghtsylfksggqsllvwgdilinhavqfakpevvwef dvdsdqarqsrqrilaeaatdklwvagahlpfpglghvreeaqgyawvpvefspirsd
Timeline for d4o98a1: