Lineage for d4o98a1 (4o98 A:26-323)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231878Species Pseudomonas oleovorans [TaxId:301] [261363] (1 PDB entry)
  8. 2231879Domain d4o98a1: 4o98 A:26-323 [261364]
    Other proteins in same PDB: d4o98a2, d4o98b2
    automated match to d4le6a_
    complexed with zn; mutant

Details for d4o98a1

PDB Entry: 4o98 (more details), 2.25 Å

PDB Description: crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w
PDB Compounds: (A:) Organophosphorus hydrolase

SCOPe Domain Sequences for d4o98a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o98a1 d.157.1.0 (A:26-323) automated matches {Pseudomonas oleovorans [TaxId: 301]}
apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
cglvnadgspaypnatvevpqaeaefwldeatmakapegmqgmfkmarqavapyakmnkl
kpyktegellpgvslvassghtpghtsylfksggqsllvwgdilinhavqfakpevvwef
dvdsdqarqsrqrilaeaatdklwvagahlpfpglghvreeaqgyawvpvefspirsd

SCOPe Domain Coordinates for d4o98a1:

Click to download the PDB-style file with coordinates for d4o98a1.
(The format of our PDB-style files is described here.)

Timeline for d4o98a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4o98a2