Lineage for d1dit.1 (1dit L:,H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056594Protein Thrombin [50531] (2 species)
  7. 2056630Species Human (Homo sapiens) [TaxId:9606] [50532] (170 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 2056736Domain d1dit.1: 1dit L:,H: [26136]

Details for d1dit.1

PDB Entry: 1dit (more details), 2.3 Å

PDB Description: complex of a divalent inhibitor with thrombin
PDB Compounds: (H:) alpha-thrombin, (L:) alpha-thrombin

SCOPe Domain Sequences for d1dit.1:

Sequence, based on SEQRES records: (download)

>g1dit.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
geadcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta
nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Sequence, based on observed residues (ATOM records): (download)

>g1dit.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
geadcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqps
vlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnr
wyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOPe Domain Coordinates for d1dit.1:

Click to download the PDB-style file with coordinates for d1dit.1.
(The format of our PDB-style files is described here.)

Timeline for d1dit.1: