Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein Galectin-1 [100925] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries) |
Domain d4no4b_: 4no4 B: [261359] automated match to d4ga9a_ complexed with gol, lat, mg, so4; mutant |
PDB Entry: 4no4 (more details), 1.4 Å
SCOPe Domain Sequences for d4no4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4no4b_ b.29.1.3 (B:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} acglvasnlnakpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym aadgdfkikcvafe
Timeline for d4no4b_: