Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Thrombin [50531] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50532] (163 PDB entries) |
Domain d1hage_: 1hag E: [26135] prethrombin 2 complexed with nag, sfo |
PDB Entry: 1hag (more details), 2 Å
SCOP Domain Sequences for d1hage_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hage_ b.47.1.2 (E:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
Timeline for d1hage_: