Lineage for d1hage_ (1hag E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670861Protein Thrombin [50531] (2 species)
  7. 670908Species Human (Homo sapiens) [TaxId:9606] [50532] (163 PDB entries)
  8. 671010Domain d1hage_: 1hag E: [26135]
    prethrombin 2
    complexed with nag, sfo

Details for d1hage_

PDB Entry: 1hag (more details), 2 Å

PDB Description: the isomorphous structures of prethrombin2, hirugen-and ppack- thrombin: changes accompanying activation and exosite binding to thrombin
PDB Compounds: (E:) prethrombin 2

SCOP Domain Sequences for d1hage_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hage_ b.47.1.2 (E:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq
ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki
yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd
sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOP Domain Coordinates for d1hage_:

Click to download the PDB-style file with coordinates for d1hage_.
(The format of our PDB-style files is described here.)

Timeline for d1hage_: