Lineage for d4lnub2 (4lnu B:246-441)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657768Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1657875Protein automated matches [227071] (2 species)
    not a true protein
  7. 1657931Species Sheep (Ovis aries) [TaxId:9940] [226224] (9 PDB entries)
  8. 1657945Domain d4lnub2: 4lnu B:246-441 [261348]
    Other proteins in same PDB: d4lnua1, d4lnub1, d4lnud_
    automated match to d3rycd2
    complexed with gdp, gol, gtp, mes, mg, so4

Details for d4lnub2

PDB Entry: 4lnu (more details), 2.19 Å

PDB Description: Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4lnub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnub2 d.79.2.1 (B:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d4lnub2:

Click to download the PDB-style file with coordinates for d4lnub2.
(The format of our PDB-style files is described here.)

Timeline for d4lnub2: