Lineage for d4lnub1 (4lnu B:1-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121690Protein automated matches [226837] (7 species)
    not a true protein
  7. 2121896Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries)
  8. 2121910Domain d4lnub1: 4lnu B:1-245 [261347]
    Other proteins in same PDB: d4lnua2, d4lnub2, d4lnud_
    automated match to d4drxb1
    complexed with gdp, gol, gtp, mes, mg, so4

Details for d4lnub1

PDB Entry: 4lnu (more details), 2.19 Å

PDB Description: Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4lnub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnub1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfifgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsihqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d4lnub1:

Click to download the PDB-style file with coordinates for d4lnub1.
(The format of our PDB-style files is described here.)

Timeline for d4lnub1: